PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.1G190100.1.p
Common NameLOC101786086, SETIT_016260mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB_related
Protein Properties Length: 911aa    MW: 93588.1 Da    PI: 10.2976
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.1G190100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.31.7e-08207249244
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                         ++W++eEd  l+ +v+++G g+W+ I+++    Rt+ q+  rw
  Seita.1G190100.1.p 207 KAWSKEEDADLAAGVQKFGEGNWDYISNKCKFDRTPDQLSQRW 249
                         58****************************9789****99999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-11200254IPR009057Homeodomain-like
PROSITE profilePS512949.93201258IPR017930Myb domain
SuperFamilySSF466898.22E-12204255IPR009057Homeodomain-like
SMARTSM007171.4E-6205255IPR001005SANT/Myb domain
PfamPF002492.9E-7207249IPR001005SANT/Myb domain
CDDcd116606.56E-11212254No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 911 aa     Download sequence    Send to blast
MAAAAAPAAG AGKGKRKRPL SEDDVYLLLH RYAPGTILTA LQEVAQHAEG GRRIDWKAVV  60
GKSATGITSA REYQMLWRHF AYNHDLDETV DAGDQPLGDD SDLELEPEPV PNPSKEALSE  120
ASALAKALIS GSSREQASGQ RVNLDAPVLN SPNEKIVRVP SEKQLAQGHR ITNVTGPVSN  180
SKQASHLGPS PGSLDPNGPS KKKKKPKAWS KEEDADLAAG VQKFGEGNWD YISNKCKFDR  240
TPDQLSQRWA LICKRPGGST KPASTKHGTV ASSEERKDAL KALSMAVGPI RRSSMLRPGA  300
YQQGIQHKSA VFAPKIPEVR PAAAPSPALA LPVPVPVPVP VPVPLPVKVQ VNSPLPQGQQ  360
APVQRAPPKL ANASNKARKK QPAQPNPPVG PSSIKEAAFA AGGRLAPAEA AADFLKVTQN  420
IRSQVTGSSK SSAGPKAPSV VVEPGTQPGS TQHLEPLSTS AHKSGPSVLT THATEQGHGA  480
SEVAVVNPPG PSDGAHSLET KKALSTTPVP GSCDIEEKED DSTFCVITID DLFPEDAMQP  540
ETVDLKAKQP EIVDQKANQQ VEIVSQRAKQ PETVDPKAKQ PETADPKAKQ PENADPKAKQ  600
PDALNPKVEM VDPKDKDMLE FDQFVASQGG VNTDHLDKSK TGGSASQAQG LAGSQKKQVK  660
LMPTVGKGNP VSAAAPATVK RIKTPVPHLV NPVPAGTPRG IVGTVNANAP NKTLVRKAAT  720
PAPAGVQAPP LKKHAVNIKG NQAMQPSTAV AGSGVPASNQ ASVAVNGASK ANPPPSSAQA  780
SAVVNIGSKA NPPSSGQASM VVNVGGKANP PSSGQASVVV NVGSKANPPS SGQASAAVNG  840
ANRVANPQSS RQASVVVNGA NRAANPQSSS QVSVAVNGSN SAANVPSSSQ AGAAASGAAN  900
KSNPPGAPKQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794560.0HF679456.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB50 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952835.10.0PREDICTED: nascent polypeptide-associated complex subunit alpha, muscle-specific form-like
TrEMBLK3YPR80.0K3YPR8_SETIT; Uncharacterized protein
STRINGSi016260m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46843754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09710.17e-31MYB_related family protein